Protein Info for MPMX20_01187 in Enterobacter sp. TBS_079

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details PF00512: HisKA" amino acids 228 to 292 (65 residues), 39.3 bits, see alignment E=8.1e-14 PF02518: HATPase_c" amino acids 338 to 445 (108 residues), 72 bits, see alignment E=8.4e-24 PF00072: Response_reg" amino acids 478 to 587 (110 residues), 37.1 bits, see alignment E=4.7e-13

Best Hits

KEGG orthology group: None (inferred from 91% identity to enc:ECL_04307)

Predicted SEED Role

"FIG01056136: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (595 amino acids)

>MPMX20_01187 Sensor histidine kinase RcsC (Enterobacter sp. TBS_079)
MRFFQGSQNDGISPPAQIRLLNNTFLRLVFSFSAVPFVGIPFAIWIHLLGGDLGPTITWI
IIYLLCAVAIRIVHRRYQREVKENDDEAVLRRWLPRINKVAFFHGLGISSLYLITPQTQN
FDFFLLLNISIAAIVAANATHLTPVISTFTRFFFASWGVLTLGIILRLDELMFIVLMLNL
LYGFAIYRHALTSHAFFIQQALLEEQSSRLAEQFRQAKEEAEQALLDKNQFLTTASHDLR
QPVHAMGFLIEAIIHRNQDDSLTPQLLDLQQSVRSVHLMFNSLLDLSKIESGNVMTAPTR
VDIGTLLDSVITLFREEANSRALRLRTWRPKRRLFVMGDPLLVRQSLINLIQNALRYTQQ
GGVLVAIRPRGAECLVEVWDTGVGIADDEKSKIFSPYYRPELAWKIDSAGHGLGLAVVAR
CAKLMNVKYGMHSIEGKGSRFWMRFTQYTGDVKAVDPLPAGDNIATPVRYAPLHGSCLIV
DDDPLVTSAWESLMSLWGINVRCAASAEDAFAIIDDGFTPFAVLCDQRLRSGESGFDILK
ALFERLPDMSGAMVSGEFNSPVLLEAEQEGYLVLRKPLEPAKLHALLTQWSAGSG