Protein Info for MPMX20_01043 in Enterobacter sp. TBS_079

Annotation: Ammonia channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 280 to 297 (18 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 31 to 426 (396 residues), 458.9 bits, see alignment E=7.5e-142 PF00909: Ammonium_transp" amino acids 33 to 426 (394 residues), 432.3 bits, see alignment E=7.7e-134

Best Hits

Swiss-Prot: 91% identical to AMTB_ECO57: Ammonia channel (amtB) from Escherichia coli O157:H7

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 98% identity to enc:ECL_01212)

MetaCyc: 91% identical to ammonium transporter (Escherichia coli K-12 substr. MG1655)
RXN-9615

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>MPMX20_01043 Ammonia channel (Enterobacter sp. TBS_079)
MKIATIKTGLGSLALLPGLALAAPAVADKADNAFMMISTALVLFMSIPGIALFYGGLIRG
KNVLSMLTQVAVTFALVCVLWVVYGYSLAFGTGNAFFGNFDWVMLKNIELTALMGSFYQY
IHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYVPIAHMVWGGGLLASHGA
LDFAGGTVVHINAAVAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYFGWFGFNAG
SASAANEIAALAFVNTVVATAGAILSWVFGEWAVRGKPSLLGACSGAIAGLVGITPACGY
VGVGGALLVGLVAGLAGLWGVTALKRVLRVDDPCDVFGVHGVCGIVGCIMTGIFAAKSLG
GVGYAEGVTMVHQVLVQLESIAITVVWSAVVAFIGYKLADMTVGLRVPEEQEREGLDVNS
HGENAYNA