Protein Info for MPMX20_00995 in Enterobacter sp. TBS_079

Annotation: Acyl carrier protein phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04336: ACP_PD" amino acids 1 to 184 (184 residues), 203.8 bits, see alignment E=1.3e-64

Best Hits

Swiss-Prot: 89% identical to ACPH_ENT38: Acyl carrier protein phosphodiesterase (acpH) from Enterobacter sp. (strain 638)

KEGG orthology group: K08682, acyl carrier protein phosphodiesterase [EC: 3.1.4.14] (inferred from 93% identity to enc:ECL_01161)

MetaCyc: 82% identical to acyl carrier protein phosphodiesterase (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] phosphodiesterase. [EC: 3.1.4.14]

Predicted SEED Role

"Acyl carrier protein phosphodiesterase (EC 3.1.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 3.1.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>MPMX20_00995 Acyl carrier protein phosphodiesterase (Enterobacter sp. TBS_079)
MNFLAHLHLAHLADSSLSGNLLADFVRGNPADAYSAEVVDGIFMHRRIDVLTDNLPEVQE
AKAWFRPETRRVAPITLDVMWDHFLSRHWETLSPEMPLNAFVRYAHQQVSIILPDSPPRF
VNLNNYLWSERWLERYREMDFIQNVLNGMASRRPRLDALRDSWHDLDAHYEALETRFWQF
YPRMMTQAKNKQL