Protein Info for MPMX20_00993 in Enterobacter sp. TBS_079

Annotation: N-substituted formamide deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 PF07969: Amidohydro_3" amino acids 52 to 536 (485 residues), 462.8 bits, see alignment E=2.3e-142 PF01979: Amidohydro_1" amino acids 406 to 535 (130 residues), 25.3 bits, see alignment E=9.2e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to eae:EAE_12475)

Predicted SEED Role

"Exoenzymes regulatory protein AepA precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (622 amino acids)

>MPMX20_00993 N-substituted formamide deformylase (Enterobacter sp. TBS_079)
MSQTATLILTKGKIHTLDRENPLTEAVAIANGKILATGNHDRIMSYATQGTQIVDLKGST
VIPGLNDSHLHLIRGGLNYNLELRWEGVPSLADALRMLKDQADRTPSPQWVRVVGGWSEF
QFAERRMPTIEELNEAAPDTPVFVLHLYDRALLNRAALKAVGYTKETPNPPGGEIVRDNH
GNPTGLLIAKPNAMILYATLAKGPKLPIEQQVNSTRQFMRELNRLGLTSAIDAGGGFQNY
PEDYEVIAELHAKEQMTVRIAYNLFTQRPKQELEDFERWTDMLKPGQGTDFYRANGAGEM
LVFSAADFEDFLQPRPDLPQGMEDELERVVRHLVENRWPFRLHATYDESISRMLDVFEKV
NREIPFNGLHWFFDHAETITERNIERVKALGGGIAVQHRMAFQGEYFVDRYGKEAVKHTP
PVAKMLELDVPVGLGTDATRVASYNPWTALYWLVSGRTVGGLAMYDDNNRLPREVALELW
TAGSAWFSSEQGKKGRLVEGQLADLVVLSKDYFSVTEEEIKGIESVLTVVDGKVVYAAGH
FSPLSPPPIPVVPSWSPVVKVPGHYRSAPPAASKVGAVVQMHQCIGSCGVHGHAHGIARQ
SDIPVSDDQEFWGVLGCSCFAF