Protein Info for MPMX20_00860 in Enterobacter sp. TBS_079

Annotation: Regulator of sigma-E protease RseP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 56 to 71 (16 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 3 to 450 (448 residues), 553.8 bits, see alignment E=1.2e-170 PF02163: Peptidase_M50" amino acids 10 to 438 (429 residues), 265.3 bits, see alignment E=8.9e-83 PF00595: PDZ" amino acids 209 to 276 (68 residues), 37.7 bits, see alignment E=5.4e-13 PF13180: PDZ_2" amino acids 212 to 287 (76 residues), 37.9 bits, see alignment E=4.2e-13 PF17820: PDZ_6" amino acids 227 to 278 (52 residues), 39.9 bits, see alignment 6.8e-14

Best Hits

Swiss-Prot: 92% identical to RSEP_SALTI: Regulator of sigma E protease (rseP) from Salmonella typhi

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 98% identity to enc:ECL_00979)

MetaCyc: 86% identical to intramembrane zinc metalloprotease RseP (Escherichia coli K-12 substr. MG1655)
3.4.21.-; RXN-18678

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>MPMX20_00860 Regulator of sigma-E protease RseP (Enterobacter sp. TBS_079)
MLSILWNLAAFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKSLWTRTDRHGTEFV
IALIPLGGYVKMLDERVEPVAPELRHSAFNNKTVGQRAAIIAAGPVANFIFAVFAYWLVF
IIGVPGVRPVVGEIAPDSIAASAQITPGMELKAIDGIETPDWDAVRLQLVAKIGDRQTTF
SVSPFGSDQRQDKVLDLRHWRFEPDKEDPVSALGIRPRGAQIEPVLAEVQANSAASKAGL
QAGDRIVKVDGQPLTEWMTFVTLVRDNPGTSLALEVERQGSPLSLTLTPDTKSVGKKAEG
FAGVVPKVIPLPDEYKTIRQYGPFSAILEATDKTWQLMKLTVNMLGKLITGDVKLNNLSG
PISIAQGAGMSAEFGVIYYLMFLALISVNLGIINLFPLPVLDGGHLLFLAIEKLKGGPVS
ERVQDFSYRIGSILLVLLMGLALFNDFSRL