Protein Info for MPMX20_00786 in Enterobacter sp. TBS_079

Annotation: Cell division protein FtsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details PF08478: POTRA_1" amino acids 59 to 128 (70 residues), 74.3 bits, see alignment E=8.1e-25 PF03799: FtsQ_DivIB_C" amino acids 132 to 249 (118 residues), 95.9 bits, see alignment E=3e-31

Best Hits

Swiss-Prot: 88% identical to FTSQ_SALTY: Cell division protein FtsQ (ftsQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 99% identity to enc:ECL_00890)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>MPMX20_00786 Cell division protein FtsQ (Enterobacter sp. TBS_079)
MSQAALNTRNRDDEEEYSSSRRSNGTRLAGIIFLLGVLCTVFISGWMVLGWMEDAQRLPL
SKLVVTGERHYTRNDDIRQTILALGSPGTFMTQDVNIIQSQIERLPWIKQASVRKQWPDE
LKIHLVEYVPIARWNDQHMVDVDGNSFSVPADRVNKQNLPMLYGPEGSENEVLQGFREMG
QVLAKDRFTLKDAAMTARRSWQLTLTNGIKLNLGRGDTMKRLARFVELYPVLQQQAQTDG
KRISYVDLRYDSGAAVGWEPAPVEEPNQQQNQAQVQAEQQ