Protein Info for MPMX20_00749 in Enterobacter sp. TBS_079

Annotation: Chaperone SurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF09312: SurA_N" amino acids 25 to 142 (118 residues), 162.5 bits, see alignment E=1.3e-51 PF13623: SurA_N_2" amino acids 27 to 103 (77 residues), 30.1 bits, see alignment E=1.2e-10 PF13624: SurA_N_3" amino acids 28 to 141 (114 residues), 52.6 bits, see alignment E=1.5e-17 PF13616: Rotamase_3" amino acids 161 to 272 (112 residues), 74.9 bits, see alignment E=2.3e-24 amino acids 282 to 383 (102 residues), 82.8 bits, see alignment E=8.4e-27 PF00639: Rotamase" amino acids 178 to 272 (95 residues), 80.9 bits, see alignment E=3.4e-26 amino acids 289 to 380 (92 residues), 87.5 bits, see alignment E=3e-28 PF13145: Rotamase_2" amino acids 188 to 274 (87 residues), 32 bits, see alignment E=5.9e-11 amino acids 303 to 383 (81 residues), 30.1 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 90% identical to SURA_SHIBS: Chaperone SurA (surA) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 98% identity to enc:ECL_00851)

MetaCyc: 90% identical to chaperone SurA (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>MPMX20_00749 Chaperone SurA (Enterobacter sp. TBS_079)
MKNWKTLLLGVAMVANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMKSVKLNSGEAGQQL
PDDATLRHQILERLIMDQIVLQMGQKMGVKVTDEQLDQAIANIAKQNNMSLDQMRSRLAY
DGISYATYRNQIRKEMLISEVRNNEVRRRVTILPQEVDALAKQVGNQNDASTELNLSHIL
IPLPENPTSDQAAEAESQARSIVEQARNGGDFGKLAITYSADQQALKGGQMGWGRIQELP
SIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQNISVTEVHARHILLKPSPIMTD
DQARVKLQQIAADIKSGKTSFANAAKEFSQDPGSANQGGDLGWAAADIYDPAFRDALMKL
NKGQMSTPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLFNRKFSEEAATWMQEQRAS
AYVKVLSN