Protein Info for MPMX20_00737 in Enterobacter sp. TBS_079

Annotation: Maltose regulon regulatory protein MalI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00356: LacI" amino acids 5 to 50 (46 residues), 64.4 bits, see alignment 1.3e-21 PF00532: Peripla_BP_1" amino acids 62 to 323 (262 residues), 127.5 bits, see alignment E=1.5e-40 PF13407: Peripla_BP_4" amino acids 64 to 312 (249 residues), 64.8 bits, see alignment E=1.9e-21 PF13377: Peripla_BP_3" amino acids 172 to 332 (161 residues), 122.9 bits, see alignment E=3e-39

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 88% identity to esc:Entcl_3687)

Predicted SEED Role

"Maltose regulon regulatory protein MalI (repressor for malXY)" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>MPMX20_00737 Maltose regulon regulatory protein MalI (Enterobacter sp. TBS_079)
MTGITLADVAKRAGVSTATVSMVLCNKGRISQRTRERVLQALDESGYVYNQTAANLRNRS
SNQVGLLLHDITNPFYGEMTAGLSHEMERHDLLLFLANSEESSERQQKFVDSLMRNNVCG
MVLCAARETPQAFFDGLKRRNIPAIMVVRPLNDPDFDFVGTDNFLGTQMATEHLLRMGHR
QIAFIGGSLNSGSRAQRIGGFTSKLLEYGVTPNPEWIVTSQASQSDGARVAEALLMNHPQ
ITAAVCYQDIVALGVMQCLRKMGREPGRHFALVGFDDITEAGLVQPALTTVSVAAKEIGR
KAGELLFSRIQGNREPAKRIILPPALVVRESCGFR