Protein Info for MPMX20_00659 in Enterobacter sp. TBS_079

Annotation: Transcriptional activator protein BglJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00196: GerE" amino acids 151 to 204 (54 residues), 42 bits, see alignment E=5.5e-15

Best Hits

Swiss-Prot: 50% identical to BGLJ_ECOLI: Transcriptional activator protein BglJ (bglJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to enc:ECL_00776)

Predicted SEED Role

"response regulator receiver protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>MPMX20_00659 Transcriptional activator protein BglJ (Enterobacter sp. TBS_079)
MDKTGSTRHIAVIENCAMSAVGLEHLFALPTLSHYQLHMFSEFDCFKKALPHVSFFSLIY
SLSDAREERRNCLASLRDLAFTHNHIQRIILAADEMEARLISHLSPSRLHGVVSKSVSLD
RLQEELLVLLSETLHINDNMLNHWYKSQNRMLSPTERAILRYMSCGFSIPEIAAQLERNI
KTIRAHKFNAMVKLGVNSDVGLLDAADILTHLPARDPRTSVLSQPTFL