Protein Info for MPMX20_00657 in Enterobacter sp. TBS_079

Annotation: Inner membrane protein YjjP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 116 to 135 (20 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 228 to 254 (27 residues), see Phobius details PF06738: ThrE" amino acids 13 to 252 (240 residues), 235.7 bits, see alignment E=2.7e-74

Best Hits

Swiss-Prot: 88% identical to YJJP_ECOLI: Inner membrane protein YjjP (yjjP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to ent:Ent638_0522)

Predicted SEED Role

"FIG023911: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>MPMX20_00657 Inner membrane protein YjjP (Enterobacter sp. TBS_079)
MQADRSTQRAITRLCIQCGLFLLQHGAESALVEELSTRLGLALGMDSVESAISSNAIVLT
TIKDGQCLTSTRKNHDRGINMHVVTEVQHIVILAEHKLLDLHDIEKRFNQIKPLRYPRWL
VVLMVGLSCACFCKLNKGGWDGAVITFFASSIAMYVRQLLTHRQLHPQINFCITAFVATT
VSGLLLRLPQFANTPTIAMAASVLLLVPGFPLINAVADMFKGHINTGLARWAIASLLTLA
TCIGVVMAMTLWGLRGWA