Protein Info for MPMX20_00619 in Enterobacter sp. TBS_079

Annotation: Transcriptional regulator SlyA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF12802: MarR_2" amino acids 34 to 93 (60 residues), 38.4 bits, see alignment E=1.7e-13 PF01047: MarR" amino acids 36 to 94 (59 residues), 37.7 bits, see alignment E=2.3e-13

Best Hits

Swiss-Prot: 30% identical to SLYA_SERS3: Transcriptional regulator SlyA (slyA) from Serratia sp. (strain ATCC 39006)

KEGG orthology group: None (inferred from 93% identity to ent:Ent638_0504)

Predicted SEED Role

"transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>MPMX20_00619 Transcriptional regulator SlyA (Enterobacter sp. TBS_079)
MREEELFSRRPMGMRMAMIVRQWRAVIDDAILETGLTQSSWTVMMQLQQLGDNVSVSELA
EVQGIELPPLMRTLTQLEKQGYLLRTVSPYDKRIRLLTLTPEGNAVLRTLSRVIETFQAR
VSQNIAPEHLDIFSATLNQIACNLRKIREEDNKTEK