Protein Info for MPMX20_00615 in Enterobacter sp. TBS_079

Annotation: Putative aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00171: Aldedh" amino acids 14 to 469 (456 residues), 518.6 bits, see alignment E=6.5e-160

Best Hits

KEGG orthology group: None (inferred from 90% identity to enc:ECL_00728)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>MPMX20_00615 Putative aldehyde dehydrogenase (Enterobacter sp. TBS_079)
MHNIEQIFINGEFVTPHGTERFDLYNPATARVIGQVRLADEVDAEHAIAAAKAAFPAWSQ
TPRQERIAALKRMHTAVAARHDALLDAVIEEYGAPASRSAWMARYPADVIAQAIEALEAF
EFVTTAGAATVQMTPLGVAGLITPWNSDAGFICGKLAAALAAGCTAVIKPSEMSALQTRI
VTEALRDAGLPPGVFNIVTGRGDTVGETISRHPDVAKISFTGSTVTGKAILRNAAESVKR
VTLELGGKSPTILLDDIDLAQAIPLVVQAGFMNSGQACVAGTRILVPQSRKAEIETALAQ
AVAAVKSGDPRDNATEIGPMVSEKQWLRVQGYIRKGLDEGANLLVGGEGRPEGTQDGWFV
RPTLFTDVTNQMAIAREEIFGPVLCVIPYQDEAEAVAIANDTEYGLSAMVLGRDVERARR
VAQQIVAGRVLVNTLAHEPKAPFGGFRHSGVGREMGEWGIRAFMEPKSILG