Protein Info for MPMX20_00538 in Enterobacter sp. TBS_079

Annotation: PTS system trehalose-specific EIIBC component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 108 to 130 (23 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details amino acids 373 to 389 (17 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details amino acids 437 to 460 (24 residues), see Phobius details TIGR01992: PTS system, trehalose-specific IIBC component" amino acids 6 to 460 (455 residues), 718.4 bits, see alignment E=4.1e-220 PF00367: PTS_EIIB" amino acids 11 to 43 (33 residues), 52.4 bits, see alignment (E = 2.7e-18) TIGR00826: PTS system, glucose-like IIB component" amino acids 30 to 111 (82 residues), 64.1 bits, see alignment E=1.2e-21 PF02378: PTS_EIIC" amino acids 112 to 404 (293 residues), 124.8 bits, see alignment E=4.1e-40

Best Hits

Swiss-Prot: 87% identical to PTTBC_ECOLI: PTS system trehalose-specific EIIBC component (treB) from Escherichia coli (strain K12)

KEGG orthology group: K02818, PTS system, trehalose-specific IIB component [EC: 2.7.1.69] K02819, PTS system, trehalose-specific IIC component (inferred from 97% identity to enc:ECL_00658)

MetaCyc: 87% identical to trehalose-specific PTS enzyme IIBC component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-168 [EC: 2.7.1.201]

Predicted SEED Role

"PTS system, trehalose-specific IIB component (EC 2.7.1.69) / PTS system, trehalose-specific IIC component (EC 2.7.1.69)" in subsystem Trehalose Uptake and Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.201 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>MPMX20_00538 PTS system trehalose-specific EIIBC component (Enterobacter sp. TBS_079)
MSKVKQEDIDQLIVLVGGRENIATVSHCITRLRFVLNDPSKADPKAIEALSMVKGCFTNA
GQFQVVIGTEVGDYYQALLATTGHSSADKEQAKKAARQNMKWHEQLISHFAEIFFPLLPA
LISGGLILGFRNVIGDVPMSDGKTLAQMYPALKTVYDFLWLIGEAIFFYLPVGICWSAVR
KMGGTPILGIVLGVTLVSPQLMNAYLLGQQVPEVWNFGLFTIAKVGYQAQVIPALLAGLT
LGFIETRLKRIVPDYLYLVVVPVCSLILAVFLAHAFIGPFGRMIGDGVAFAVRHLMTGSF
APIGAMLFGFLYAPLVITGVHQTTLAIDMQMIQSLGGTPVWPIIALSNIAQASAVTGIIL
VSRKRNEREISVPAAISAYLGVTEPAMYGINLKYRFPMLCAMIGSGLAGLVCGLYGVMAN
GIGVGGLPGILSIQPAFWQVFSLAMVIAIVVPMALTTVVYQRKYRQGALQIV