Protein Info for MPMX20_00487 in Enterobacter sp. TBS_079

Annotation: Inner membrane protein YtfF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 5 to 25 (21 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details PF00892: EamA" amino acids 3 to 129 (127 residues), 50.5 bits, see alignment E=1.3e-17 amino acids 158 to 306 (149 residues), 33.5 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 83% identical to YTFF_ECOLI: Inner membrane protein YtfF (ytfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to enc:ECL_00604)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>MPMX20_00487 Inner membrane protein YtfF (Enterobacter sp. TBS_079)
MISGVLYALLAGLMWGLIFVGPLIVPEYPAILQSTGRYLALGLIALPLAWLGRARLRQLG
RQDWFTALALTMMGNLIYYVCLASAIQRTGAPVSTMIIGTLPVVIPVFANLLYSHRDGKL
AWSKLVPALVCTAVGLVCVNIAELQHGLEDFSLLRYGSGILLAFVSVVCWAWYALRNARW
LRENPDKHPMMWATAQALVTLPVSLMGYMGACLWLGHQQPDFAQPFGPRPWVFVGLMLAI
AVLCSWVGALCWNIASQKLPTVILGPLIVFETLAGLLYTFLMRQSVPPLLTACGIILLVV
GVVMAVRAKPEKPMVVPASES