Protein Info for MPMX20_00485 in Enterobacter sp. TBS_079

Annotation: Iron-sulfur cluster repair protein YtfE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF04405: ScdA_N" amino acids 5 to 58 (54 residues), 69.8 bits, see alignment E=1.3e-23 TIGR03652: iron-sulfur cluster repair di-iron protein" amino acids 8 to 216 (209 residues), 262.5 bits, see alignment E=1.6e-82 PF01814: Hemerythrin" amino acids 77 to 216 (140 residues), 94.4 bits, see alignment E=7.8e-31

Best Hits

Swiss-Prot: 94% identical to YTFE_CITK8: Iron-sulfur cluster repair protein YtfE (ytfE) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K07322, regulator of cell morphogenesis and NO signaling (inferred from 92% identity to eco:b4209)

MetaCyc: 92% identical to iron-sulfur cluster repair protein YtfE (Escherichia coli K-12 substr. MG1655)
1.7.99.-

Predicted SEED Role

"Nitric oxide-dependent regulator DnrN or NorA" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>MPMX20_00485 Iron-sulfur cluster repair protein YtfE (Enterobacter sp. TBS_079)
MAFRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAASRKELDVGLIEAELAQLAE
QPIEKDWRTAALADIIDHIIVRFHDRHREQLPELILQATKVERVHADKPSVPRGLAKYLT
LLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDDAGELLEVIKHTTHNVTPP
PEACTTWKAMYNGINEMIDDLMEHISIENNVLFPRALAGE