Protein Info for MPMX20_00367 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details PF00892: EamA" amino acids 13 to 144 (132 residues), 75.7 bits, see alignment E=2.3e-25 amino acids 157 to 292 (136 residues), 70 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 45% identical to Y281_BUCAI: Uncharacterized transporter BU281 (BU281) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: None (inferred from 46% identity to kpu:pK2044_00090)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>MPMX20_00367 hypothetical protein (Enterobacter sp. TBS_079)
MKGFSRSGSLITAALFLAVSVTWGTTWMAMKIALTSFTPVLATGLRFLIASPVLIGLARA
GGHPLLFPAGKRRFQCCLALFYFSVPFSLMIYGEETISSGMASLLFSVMPVAILSVSWLL
TRQGVNPVQLAGTVIVMLSLATIITSETGTAEIQSWKGVVAILAAVCCHAFMYVLCKKHC
AGISVLTSNALPCLGAAFILLCSGLMQPHAHSSPVDARAVAAVIYLGVVAGILGIMAYFQ
LQQRVTPFRASMVYFIFPLIALSLDDILSGQTIAPLSALMIIPFLGGIFLVLRPPQRLTR
LRQPE