Protein Info for MPMX20_00327 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR00686: putative alkylphosphonate utilization operon protein PhnA" amino acids 2 to 111 (110 residues), 202.4 bits, see alignment E=6.6e-65 PF08274: YjdM_Zn_Ribbon" amino acids 2 to 31 (30 residues), 64.7 bits, see alignment E=6e-22 PF03831: YjdM" amino acids 44 to 111 (68 residues), 118.6 bits, see alignment E=8.6e-39

Best Hits

Swiss-Prot: 91% identical to YJDM_ECO57: Protein YjdM (yjdM) from Escherichia coli O157:H7

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 91% identity to ecy:ECSE_4406)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>MPMX20_00327 hypothetical protein (Enterobacter sp. TBS_079)
MQLPHCPKCNSEYTYEDNGMFICPECAHEWNDAEPSHDTDTLVVKDANGNLLADGDSVTV
IKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMKLKSEFVKKN