Protein Info for MPMX20_00316 in Enterobacter sp. TBS_079

Annotation: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02324: phosphonate C-P lyase system protein PhnL
  • amino acids 1 to 218 (218 residues), 356.2 bits, E=3.2e-111
• PF00005: ABC_tran
  • amino acids 24 to 178 (155 residues), 107.1 bits, E=1.2e-34

Best Hits

Swiss-Prot: 86% identical to PHNL_ECOLI: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL (phnL) from Escherichia coli (strain K12)

KEGG orthology group: K05780, putative phosphonate transport system ATP-binding protein (inferred from 93% identity to enc:ECL_00353)

MetaCyc: 86% identical to ATP-binding cassette protein PhnL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphonates transport ATP-binding protein PhnL" in subsystem Alkylphosphonate utilization

Protein Sequence (226 amino acids)

>MPMX20_00316 Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL (Enterobacter sp. TBS_079)
MIRVENVSKTFVLHQQNGVRLPVLHSASLDVSKGECVVLHGHSGSGKSTLLRSLYANYLP
DEGHIYIRHGNEWVDLVQAPARKVLDVRRSTIGWVSQFLRVIPRISALDVVMQPLLDLGV
PRETCAAKAAGLLTRLNVPEHLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASL
DSKNSAAVVELIEQAKARGAAIVGIFHDDTVRSRVADRLHPMGTLA