Protein Info for MPMX20_00256 in Enterobacter sp. TBS_079

Annotation: 4-hydroxybenzoate octaprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 99 to 132 (34 residues), see Phobius details amino acids 152 to 182 (31 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 11 to 287 (277 residues), 370.7 bits, see alignment E=2.6e-115 PF01040: UbiA" amino acids 28 to 271 (244 residues), 254.5 bits, see alignment E=4.9e-80

Best Hits

Swiss-Prot: 92% identical to UBIA_ENT38: 4-hydroxybenzoate octaprenyltransferase (ubiA) from Enterobacter sp. (strain 638)

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 96% identity to enc:ECL_00296)

MetaCyc: 90% identical to 4-hydroxybenzoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
4-hydroxybenzoate nonaprenyltransferase. [EC: 2.5.1.39]

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>MPMX20_00256 4-hydroxybenzoate octaprenyltransferase (Enterobacter sp. TBS_079)
MEWNLTQNKLLAYHRLMRTDKPIGALLLLWPTLWALWVATPGVPPLWILGVFIAGVWLMR
AAGCVVNDYADRKFDGHVKRTAHRPLPSGQVTEKEARTLFIVLVLLSFLLVLTLNTMTIL
LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA
VAYDTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGILQVAVLALMVTMGYLNGLNWAFY
WAVLVAGMLFVYQQKLIAKREREACFKAFMNNNYVGLVLFLGLAMSYFS