Protein Info for MPMX20_00157 in Enterobacter sp. TBS_079

Annotation: Iron-sulfur protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF12800: Fer4_4" amino acids 9 to 22 (14 residues), 13.9 bits, see alignment (E = 3e-05) amino acids 81 to 97 (17 residues), 22.9 bits, see alignment (E = 3.7e-08) PF13247: Fer4_11" amino acids 51 to 137 (87 residues), 42.4 bits, see alignment E=3.5e-14 PF25160: LdpA_Fe-S-bd" amino acids 58 to 101 (44 residues), 30.1 bits, see alignment E=1.7e-10 PF13237: Fer4_10" amino acids 78 to 130 (53 residues), 28.5 bits, see alignment E=6e-10 PF12837: Fer4_6" amino acids 79 to 98 (20 residues), 27.7 bits, see alignment (E = 9.6e-10) PF00037: Fer4" amino acids 79 to 99 (21 residues), 30.3 bits, see alignment (E = 1.3e-10) PF12838: Fer4_7" amino acids 83 to 133 (51 residues), 27.5 bits, see alignment E=1.8e-09 PF13187: Fer4_9" amino acids 83 to 133 (51 residues), 30.4 bits, see alignment E=1.6e-10 PF12798: Fer4_3" amino acids 84 to 98 (15 residues), 17.8 bits, see alignment (E = 2.4e-06)

Best Hits

Swiss-Prot: 60% identical to YSAA_ECOLI: Putative electron transport protein YsaA (ysaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to enc:ECL_00193)

Predicted SEED Role

"Electron transport protein HydN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>MPMX20_00157 Iron-sulfur protein (Enterobacter sp. TBS_079)
MNRFILADTEKCIGCRTCEVACVVSHQGMLSAGAFTPRIRVVKGGAFTTAVGCHQCEDAP
CATVCPTQAIRHTAGAWRVEPARCIGCKSCVVACPFGAMQVQRVGNRVQAVKCDLCADRE
AGPACVEACPTHALRCVDPARLRTERLHNLA