Protein Info for MPMX20_00152 in Enterobacter sp. TBS_079

Annotation: Putative tartrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 269 (245 residues), 161 bits, see alignment E=3.8e-51 amino acids 250 to 418 (169 residues), 57.7 bits, see alignment E=9.7e-20 PF00083: Sugar_tr" amino acids 53 to 413 (361 residues), 33.8 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to enc:ECL_00188)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>MPMX20_00152 Putative tartrate transporter (Enterobacter sp. TBS_079)
MNISTHALQADIPRQRWLRIIPPILIACIISYMDRVNIAFAMPGGMDEELGISATMAGLA
GGIFFIGYLFLQVPGGKIAVHGSGKKFIGWSLVAWAVISVLTGVVTNQYQLLALRFLLGV
AEGGMLPVVLTMISNWFPDAERGRANAIVIMFVPIAGIITAPLSGWIITALDWRWLFIIE
GLMSIVVLVLWVFTVYDRPQEARWISEAEKNYLIQTLAAEQQAIAGKAVKNASLSAVLSD
KTMWQLIALNFFYQTGIYGYTLWLPTILKELTHTSIGQVGMLAILPYVGAIAGMFLFSSL
SDRTGKRKLFVSLPLIGFALCMFLSVALKENIWLAYAALVGCGFFLQSAAGVFWTIPARL
FSAEMAGGARGVINALGNLGGFCGPYAVGVLITLYSKDAGVYCLAVSLALASLLALMLPA
KCDAGAEPNPGVNPHKHAA