Protein Info for MPMX20_00145 in Enterobacter sp. TBS_079

Annotation: Non-reducing end beta-L-arabinofuranosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 PF07944: Beta-AFase-like_GH127_cat" amino acids 12 to 427 (416 residues), 371.3 bits, see alignment E=8.7e-115 PF20736: Glyco_hydro127M" amino acids 438 to 532 (95 residues), 79.9 bits, see alignment E=2e-26 PF20737: Glyco_hydro127C" amino acids 534 to 648 (115 residues), 90.5 bits, see alignment E=7e-30

Best Hits

KEGG orthology group: K09955, hypothetical protein (inferred from 91% identity to enc:ECL_00181)

Predicted SEED Role

"Putative glycosyl hydrolase of unknown function (DUF1680)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>MPMX20_00145 Non-reducing end beta-L-arabinofuranosidase (Enterobacter sp. TBS_079)
MSIMEADLHTLNINDPFLGQYQRLVRDVVIPYQWDALNDRVTEAEPSHAITNFRIAAGLE
QGEFYGMVFQDSDVAKWLEAVAWSLCQKPDPEREKTADEVIELIAAAQCDDGYLNTYFTV
KAPGERWTNLAECHELYCAGHMIEAGVAYFQGTGKRRLLEVVCKLADHIDRVFGPGEEQL
HGYPGHPEIELALMRLYDVTQEPRYLALVKYFIDTRGTQPHFYDIEYEKRGRTSYWNTYG
PAWMVKDKAYSQAHQPLAEQHTAIGHAVRFVYLMAGMAHLARLSHDEDKRQDCLRLWNNM
AQRQLYITGGIGSQSSGEAFSSDYDLPNDTVYAESCASIGLMMFARRMLEMEADSQYADV
MERALYNTVLGGMALDGKHFFYVNPLEVHPKTLAFNHVYDHVKPVRQRWFGCACCPPNIA
RVLTSLGHYLYTVRQDALFINLYVGNDVSIPVDEGTLQLRISGNYPWQEEVNIEITSPAP
VTHTLALRLPDWCTSPAVSLNGERVTGDVSRGYLYLTRRWQEGDTLTLTLPMPVRRVYGN
PLVRQQAGKVALQRGPLVYCLEEADNGANLHNLSLPEQSEFRVFEGKGIFAHKILIQAEG
IARHADEEGTQALWQYDRAPVQRQPRTLTFIPWFSWANRGEGEMRIWVDEA