Protein Info for MPMX20_00056 in Enterobacter sp. TBS_079

Annotation: Outer membrane protein OprM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 8 to 452 (445 residues), 356 bits, see alignment E=1.5e-110 PF02321: OEP" amino acids 57 to 240 (184 residues), 78 bits, see alignment E=4.2e-26 amino acids 272 to 436 (165 residues), 106 bits, see alignment E=1.1e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to enc:ECL_00053)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>MPMX20_00056 Outer membrane protein OprM (Enterobacter sp. TBS_079)
MFRVSVLVLALLSAGCVSLDPTYQRPDAPVPATLPGAHGEATAVVSQWQQVMNDHRLNRV
VTMALTSNRDVQKAIADIDAARAQYGETRSSLFPSVDASLSHTRSRTLASGVSTSDEANG
AVSSFELDLFGRNQSLSRAARETWLASEFTAQNTRLTMVSELTTAWITLAADNSNLALAK
STQESAANSLKIVQRQQDVGVAAATDVSEAMAVYQQARASVASYQTLVMQDKNALNLLAG
ETVPENLLPGTLESLSDNAITLIPAGVSSATLLRRPDIQEAEHNLLSANANIGAARANFF
PTISLTTSAGVGSDSLSSLFSHGMKVWSFAPSISLPLFSGGNNMAQLRYAEAEKKGLIAT
YEKTIQSAFKDVADALARRETLSEELDAQREYVAAEQKTLDVATRSYQLGAGDYLTVLTA
QRALWSARASLIALQQTDFENRITLWQSLGGGIQ