Protein Info for MMP_RS09040 in Methanococcus maripaludis S2

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 PF07728: AAA_5" amino acids 359 to 441 (83 residues), 35.3 bits, see alignment E=1.7e-12 PF28529: McrB_lid" amino acids 462 to 528 (67 residues), 78.2 bits, see alignment E=5.5e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0755)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ74 at UniProt or InterPro

Protein Sequence (604 amino acids)

>MMP_RS09040 AAA family ATPase (Methanococcus maripaludis S2)
MNGHTNAVYFLNCSDDEENFNLCLEHDVAGFTSTGYEIGDLAYIILKKGRIWYLGGKGVL
EKETDLKPWKDAARYNSVFKINWDVCNLTPITEGLQHIYDNFGLAIQGKKDLRNFLGKGD
EIVSYLDSVISKNRTTRRNVVRRDTIINNPINIGEDETDKEYALNTILYGPPGTGKTYRV
IEEAVAIIDGKIPKGRVNLVKRYKELKERGQIEFITFHQSYCYEDFIEGIKPVLENSDEN
SIEYKIEDGIFKKMVNKAIEVKSSSNFDEKYAKFVEDVLEQDGIELETLAQKKPFRVRIN
SNETAVAIPKTEAATRLSVTKEMLRDYIVNDNIQGWKPYTPAIGEYLKNKYGITVENTDN
TNKKFVLIIDEINRGNISKIFGELITLIEPDKRIGELNELTVTLPYSKKDFGLPSNLYIL
GTMNTADRSIALVDTALRRRFEFNEMMPDVKKLGFDIKGIQIDIMLESINKRIEYFRGRD
HTIGHAYFMDLINETNEQVRFKKLQEIFQYKVIPLLQEYFYENWETIQYILGDHPDQLKR
FKDNPELTIVQRDNTNLRNLFGADMGDSENPNGYFINPRLKDGEMHPNAFIKIYNSKVNE
SLEY