Protein Info for MMP_RS08830 in Methanococcus maripaludis S2

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00025: Arf" amino acids 3 to 154 (152 residues), 36.6 bits, see alignment E=1.3e-12 TIGR00231: small GTP-binding protein domain" amino acids 3 to 129 (127 residues), 77.4 bits, see alignment E=5.5e-26 PF10662: PduV-EutP" amino acids 6 to 155 (150 residues), 21.2 bits, see alignment E=8.7e-08 PF01926: MMR_HSR1" amino acids 6 to 111 (106 residues), 55.5 bits, see alignment E=2.3e-18 PF00009: GTP_EFTU" amino acids 6 to 154 (149 residues), 66.6 bits, see alignment E=9e-22 PF08477: Roc" amino acids 6 to 113 (108 residues), 40.4 bits, see alignment E=1.3e-13 PF02421: FeoB_N" amino acids 6 to 153 (148 residues), 28 bits, see alignment E=5.7e-10 PF00071: Ras" amino acids 6 to 118 (113 residues), 42.7 bits, see alignment E=1.9e-14 PF03029: ATP_bind_1" amino acids 33 to 132 (100 residues), 29.3 bits, see alignment E=3.1e-10

Best Hits

KEGG orthology group: K06945, (no description) (inferred from 100% identity to mmp:MMP1715)

Predicted SEED Role

"M. jannaschii predicted coding region MJ1339"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWJ4 at UniProt or InterPro

Protein Sequence (157 amino acids)

>MMP_RS08830 GTP-binding protein (Methanococcus maripaludis S2)
MVKELKIVVMGSEDVGKTTLMENLIKNVGKVEHNGTTVAIDYGRIEMDDKKFHFFGTPGQ
ERFGFMREIAVEGADYALLVLDATVGLRKVDNDIINLLSTKNIPFSVFINKMDLCNESNA
VEIINNLNGLIESSNIVTGSIYRKEGLSEIMDQLKII