Protein Info for MMP_RS08800 in Methanococcus maripaludis S2

Annotation: 50S ribosomal protein L44e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF00935: Ribosomal_L44" amino acids 16 to 92 (77 residues), 99 bits, see alignment E=8e-33

Best Hits

Swiss-Prot: 72% identical to RL44E_METJA: 50S ribosomal protein L44e (rpl44e) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02929, large subunit ribosomal protein L44e (inferred from 98% identity to mmz:MmarC7_0984)

Predicted SEED Role

"LSU ribosomal protein L44e" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWK0 at UniProt or InterPro

Protein Sequence (93 amino acids)

>MMP_RS08800 50S ribosomal protein L44e (Methanococcus maripaludis S2)
MKMKKKINRYCPYCKKHTAHTVERAKKRKASELKWGQRQFRRVTAGYGGYPRPLPGGAKP
IKKLDLRYKCSECGKMHTRSNGGFRARMFELTE