Protein Info for MMP_RS08695 in Methanococcus maripaludis S2

Annotation: ferredoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 68 PF13237: Fer4_10" amino acids 2 to 58 (57 residues), 31.7 bits, see alignment E=5.3e-11 PF00037: Fer4" amino acids 3 to 24 (22 residues), 25.9 bits, see alignment E=2.9e-09 amino acids 42 to 63 (22 residues), 23.6 bits, see alignment E=1.6e-08 PF12800: Fer4_4" amino acids 8 to 22 (15 residues), 15.3 bits, see alignment 9.4e-06 amino acids 44 to 59 (16 residues), 16.9 bits, see alignment 2.9e-06 PF13187: Fer4_9" amino acids 9 to 62 (54 residues), 31.8 bits, see alignment E=5.2e-11 PF12838: Fer4_7" amino acids 10 to 61 (52 residues), 35 bits, see alignment E=7.2e-12

Best Hits

Swiss-Prot: 71% identical to FER3_METJA: Uncharacterized ferredoxin MJ0146 (MJ0146) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00176, 2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC: 1.2.7.3] (inferred from 98% identity to mmz:MmarC7_0962)

MetaCyc: 100% identical to 2-oxoglutarate ferredoxin oxidoreductase delta subunit (Methanococcus maripaludis)
2-oxoglutarate synthase. [EC: 1.2.7.3]

Predicted SEED Role

"2-oxoglutarate oxidoreductase, delta subunit, putative (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWM2 at UniProt or InterPro

Protein Sequence (68 amino acids)

>MMP_RS08695 ferredoxin family protein (Methanococcus maripaludis S2)
MKIIIDENYCKGCDICIEVCPKDVYKKSETLNKKGIYPPNPVNPKECTNCQLCILQCPDQ
AITVETEE