Protein Info for MMP_RS08650 in Methanococcus maripaludis S2

Annotation: glutamine--fructose-6-phosphate transaminase (isomerizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 599 (598 residues), 647.6 bits, see alignment E=9.8e-199 PF13522: GATase_6" amino acids 65 to 197 (133 residues), 57.6 bits, see alignment E=2.1e-19 PF13537: GATase_7" amino acids 81 to 203 (123 residues), 58.3 bits, see alignment E=1.2e-19 PF01380: SIS" amino acids 290 to 415 (126 residues), 80.4 bits, see alignment E=1.6e-26 amino acids 458 to 575 (118 residues), 38.6 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 100% identical to GLMS_METMP: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 100% identity to mmp:MMP1680)

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWM9 at UniProt or InterPro

Protein Sequence (599 amino acids)

>MMP_RS08650 glutamine--fructose-6-phosphate transaminase (isomerizing) (Methanococcus maripaludis S2)
MCGIIGYIGNEKASKILLKGLKRLEYRGYDSCGIATIDDTIKLKKNTGKVLEVSKKENFE
DMTGFIGIGHSRWATHGGITKNNAHPHYDCSEKICIAHNGIISNYKELKELLISKGHIFK
SETDTEVIPHLIEEEIKDFKEITEKTYINAIQNTIKKLNGTYALLILNQDFPEMLVGVRN
ESPLILGIKKDECFIGSDISAFLEYTKLAMPLNDRDIVILRKENDEIDIEVLNYGKQVQR
DTIELQWDMESAEKEGYEHFMLKEIMEEPVILKNSMKISKLEIENLGKEIEKCDKIYITA
MGTSLHAAMVAEYWFSGLNKLVIPIDSSEFLTKGIVDEKTLVIAITQSGETYDTMKAVKY
AKEKGAKTATIVNVLGSTATREADITIMMGSGLEIAVCATKTFMSQLVILYRLFIEYGKI
IGKNMDIFEKELLNIPNYISKVLDEKENISKIAEELTAKNYLFISKGINLANALEGALKF
KEITYLHAEGMSSGFLKHGTISLIDENMDTVALIPPSKSELLNSVLSNVEEIKARNGKII
GISPVEDNLKYSIKVPDVIEEVSPFVYATACQLLAYYKAVDLKRDVDKPRGLAKSVTVE