Protein Info for MMP_RS08620 in Methanococcus maripaludis S2

Annotation: flagellar accessory protein FlaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF06745: ATPase" amino acids 17 to 222 (206 residues), 47.3 bits, see alignment E=9.1e-17

Best Hits

Swiss-Prot: 79% identical to FLAH_METVO: Putative flagella-related protein H (flaH) from Methanococcus voltae

KEGG orthology group: K07331, archaeal flagellar protein FlaH (inferred from 100% identity to mmp:MMP1674)

Predicted SEED Role

"Flagella-related protein FlaH" in subsystem Archaeal Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWN5 at UniProt or InterPro

Protein Sequence (230 amino acids)

>MMP_RS08620 flagellar accessory protein FlaH (Methanococcus maripaludis S2)
LKLARIELSRDDVHKRLGGGIPFGSVILIEGEESSGKSIFCQRLAYGFLQNSYSLSYVST
QLTTTEFVKQMMSLKYTINKKLLDGNLLYIPVYPLISENAIKDDFIKKVMHTRAFYEKDI
VLFDSISTLVSNDASEVQITDLMAFFKRIASMNKIIIYTVNPKELPESILTILRTSATIV
IKTATYSFGGNLKNSAKIEKYNFAKSSFQKVMVFRVDPGLGIAVEISSVA