Protein Info for MMP_RS08595 in Methanococcus maripaludis S2

Annotation: flagellar protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF05377: FlaC_arch" amino acids 58 to 112 (55 residues), 78.9 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 82% identical to FLAC_METVO: Putative flagella-related protein C (flaC) from Methanococcus voltae

KEGG orthology group: K07822, archaeal flagellar protein FlaC (inferred from 100% identity to mmp:MMP1669)

Predicted SEED Role

"Flagella-related protein FlaC" in subsystem Archaeal Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWP0 at UniProt or InterPro

Protein Sequence (186 amino acids)

>MMP_RS08595 flagellar protein C (Methanococcus maripaludis S2)
MPNISEIIEEIKKKIKLGKKTEESSEPEPDDEFSFTLEEEAVNESEDLFAANEELLAKIG
ELESKFPKIEMMVTNLRKENENLRGDIQNINENFQDMMALYEVVSNQINPFIGISKITAT
SMEKVEMMENESRNLKKRVEELQNDVVILANVYLNTHQIDLDGVINEVLAEEEFSKAISG
EDSDDW