Protein Info for MMP_RS08475 in Methanococcus maripaludis S2

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 75 (24 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 186 to 212 (27 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details TIGR01581: NifC-like ABC-type porter" amino acids 30 to 251 (222 residues), 252.6 bits, see alignment E=1.6e-79 PF00528: BPD_transp_1" amino acids 69 to 251 (183 residues), 58.2 bits, see alignment E=4.7e-20

Best Hits

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to mmp:MMP1650)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWQ7 at UniProt or InterPro

Protein Sequence (260 amino acids)

>MMP_RS08475 ABC transporter permease (Methanococcus maripaludis S2)
MQLISFKKMSIFLTFLFTFLLFLSISSLILVPKFDDVLSSIFNPEMIYSLKVSLYSSLIS
TGIVLGFSIPTGYAISRYSFPGKSIVKAILDLPIAFPELVLGLALLLLFGQTFIGDILEF
FGIKVVFTKLGIVVAQIFTALPYAIRIVCSTFQDINPRYELVSRSLGYSEFETFKNVTLP
MARSGIFASSIIAFARCMGTFGTVLMLAGGTYMYTETLPITLYLNMSYGNLGMAISSGIV
LLMISFIAILIFEKYEGGKF