Protein Info for MMP_RS08425 in Methanococcus maripaludis S2

Annotation: methionine adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01941: AdoMet_Synthase
  • amino acids 3 to 400 (398 residues), 576.6 bits, E=1.2e-177

Best Hits

Swiss-Prot: 100% identical to METK_METMP: S-adenosylmethionine synthase (mat) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to mmp:MMP1640)

Predicted SEED Role

"Archaeal S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis (EC 2.5.1.6)

MetaCyc Pathways

• S-adenosyl-L-methionine salvage II (3/3 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• aspartate superpathway (18/25 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (1/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)
• superpathway of L-methionine salvage and degradation (3/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See P0CW63 at UniProt or InterPro

Protein Sequence (405 amino acids)

>MMP_RS08425 methionine adenosyltransferase (Methanococcus maripaludis S2)
LANIVVKRLERTPIDEIPVEIVERKGIGHPDSICDGIAESVSVALCKMYKEKMGVVLHHN
TDQVELVGGYAYPELGGGCMVSPIYILLSGRATMEVLDKETGKIIKLPVNTTAVNAARDY
LKKALRNMDLEKDVVVDCRIGQGSVDLVEVFDRKRTEIPHANDTSFGVGHAPLSTTEKIV
LETEKLLNSDALKAEIPAVGEDIKVMGLREGKKITLTIAMAAVDKYVNSCADYVKVKELA
KAKVEENAKKYLDGHELEVCINTADDDEDCIFLTVTGTSAEMGDDGSVGRGNRANGLITP
FRPMSMEATSGKNPINHIGKIYNILSNIIAEDVAKIEGVRECQIRILSQIGKPVTEPKIL
DIEMIPENGFELEELSPKAKEVAQKWLDNISEVTERIVSGNVTTF