Protein Info for MMP_RS08400 in Methanococcus maripaludis S2

Annotation: MJ0307 family thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 TIGR00411: redox-active disulfide protein 1" amino acids 2 to 80 (79 residues), 113.6 bits, see alignment E=1.7e-37 PF13192: Thioredoxin_3" amino acids 2 to 74 (73 residues), 60.8 bits, see alignment E=2.6e-20 PF00462: Glutaredoxin" amino acids 4 to 63 (60 residues), 42.7 bits, see alignment E=1.3e-14 PF00085: Thioredoxin" amino acids 7 to 79 (73 residues), 36.6 bits, see alignment E=9.9e-13

Best Hits

Swiss-Prot: 69% identical to THIO_METJA: Thioredoxin (trx) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 92% identity to mmq:MmarC5_1773)

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWS1 at UniProt or InterPro

Protein Sequence (80 amino acids)

>MMP_RS08400 MJ0307 family thioredoxin (Methanococcus maripaludis S2)
MVKIEVFTSPMCPHCPAAKRIVDEVAKEIEGIEVVHINVMEHPEKAAELGIMAVPTVAIN
GEVKFVGAPTKDALIAELKK