Protein Info for MMP_RS08380 in Methanococcus maripaludis S2

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 176 (18 residues), see Phobius details PF01569: PAP2" amino acids 57 to 179 (123 residues), 95.4 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1631)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWS5 at UniProt or InterPro

Protein Sequence (182 amino acids)

>MMP_RS08380 phosphatase PAP2 family protein (Methanococcus maripaludis S2)
MLIKTLQKTDIDLFYLVNSGVKNPLFDFLTIFISDTVYISILLISYFSFKNDKKVLIQVL
FAMFLLSIFVFAVKYGVSEPRPYEMLEGVILLKNMGTQPSFPSGHTTLAFGFWIIFTRNI
KNSKIISSKKVFEIMIMLLWAFLVAFSRVYVGVHFPHDVLGGMLIGIVFGYIFIRFSEKI
IK