Protein Info for MMP_RS08200 in Methanococcus maripaludis S2

Annotation: archaeosine synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 PF17884: DUF5591" amino acids 246 to 391 (146 residues), 151.1 bits, see alignment E=2.2e-48 TIGR00451: uncharacterized domain 2" amino acids 475 to 536 (62 residues), 40.8 bits, see alignment E=1.1e-14 PF01472: PUA" amino acids 475 to 537 (63 residues), 58.9 bits, see alignment E=3.8e-20

Best Hits

Swiss-Prot: 58% identical to ARCS_METJA: Archaeosine synthase (arcS) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07557, archaeosine tRNA-ribosyltransferase [EC: 2.4.2.-] (inferred from 100% identity to mmp:MMP1595)

MetaCyc: 58% identical to archaeosine synthase monomer (Methanocaldococcus jannaschii)
RXN-12145 [EC: 2.6.1.97]

Predicted SEED Role

"archaeosine tRNA-ribosyltransferase (EC 2.4.2.-) type 2" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 2.6.1.97

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWV9 at UniProt or InterPro

Protein Sequence (538 amino acids)

>MMP_RS08200 archaeosine synthase subunit alpha (Methanococcus maripaludis S2)
MLEPILYDIGRICKEKHESNSFSTTPKIIEFDINVPPLKTLKIPFDAPREVAEELVKLNK
SEYVRKSEVSYQIINAGKYADLIDIEENMDVYVISDLRQIIKRREMIEIIPKVREMISPN
SGIYVPGAMPLEIPLLVYMGADYFDYSSASYYAAQGYKFSKNRLIKSEEDFESLKTFNES
IIDQVLEEVKFCIESGSLRNLVEETTISNPYLRSNYRRFKPELTNIPISKSNKIIVTIDE
TKIPEVQKYIERAKNYEPYTNVIILLPCSSKKPYSYSKSHQFFINAINSVRMPVEELILT
SPYGVVPRALERLVDYDIPVTGEWSSDEIDFINKYLKNYIEIAKSKFEEVKIIAHLPEHY
LEILDIDEDYIISSDGNPTSDNSLKNLKNILKELDQTADSKSKRAQRLHNYQELAKFQLG
KNFLPEDVMIKGRHVKFFIKEGKNTVQLASINDNGLFVLTSQGGELLGKTNWVEVDFNVK
KGSLFAPGFKDADEAVSVNDEVVIVKDNEVLGVGRALMSGKEMKKATHGVLVNIRHVK