Protein Info for MMP_RS08165 in Methanococcus maripaludis S2

Annotation: phosphoglycerate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 368 to 389 (22 residues), see Phobius details TIGR01327: phosphoglycerate dehydrogenase" amino acids 3 to 522 (520 residues), 688.2 bits, see alignment E=4.1e-211 PF00389: 2-Hacid_dh" amino acids 4 to 311 (308 residues), 140.6 bits, see alignment E=7.6e-45 PF02826: 2-Hacid_dh_C" amino acids 105 to 279 (175 residues), 223 bits, see alignment E=5.5e-70 PF19304: PGDH_inter" amino acids 322 to 431 (110 residues), 92.4 bits, see alignment E=6.9e-30 PF01842: ACT" amino acids 451 to 513 (63 residues), 46.1 bits, see alignment E=9.7e-16 PF22629: ACT_AHAS_ss" amino acids 456 to 515 (60 residues), 28.6 bits, see alignment E=3.9e-10

Best Hits

Swiss-Prot: 66% identical to SERA_METJA: D-3-phosphoglycerate dehydrogenase (serA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00058, D-3-phosphoglycerate dehydrogenase [EC: 1.1.1.95] (inferred from 100% identity to mmp:MMP1588)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWW6 at UniProt or InterPro

Protein Sequence (523 amino acids)

>MMP_RS08165 phosphoglycerate dehydrogenase (Methanococcus maripaludis S2)
MSKILITDPLHESAVEILKQAGEVEVATGLTVEELKLKIKDVDALVIRSGTTATREIIEA
SENLKVIARAGVGVDNVDLDAATEKGIVVVNAPDASSISVAELLFGMMLAAARNIPQATA
SIKSGKWDRKSFKGMEIYGKTLGIVGLGRIGQQVAKRAQAFGMTIVAYDPYIPEDVASEL
GIKLLTVDELCTVSDFITLHVPLTPKTKHMIGKEQIALMKSNMVIMNCARGGLIDEAALY
DALNSGKIKAAALDVFEQEPPKESPLLTLNNLIGTPHQGASTEEAQLSAGTIVAEQTVKI
LKGESAENVVNLPMVPTEKMKKLKPYMVLAEKMGSMAIQYLDNSIELLEITYMGGLAKEK
TEILKRSFLKGILAPILLAGVNLVNAPVIAKSRNIKIAEGTMSESDYGNSIKISAKGEND
EISIIGSIEHNEVVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGM
QVGRREPGGHSIMFLDIDHMISDEVLDEIRKMENVRAAKSINI