Protein Info for MMP_RS08145 in Methanococcus maripaludis S2

Annotation: polyamine aminopropyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF17284: Spermine_synt_N" amino acids 6 to 57 (52 residues), 57.4 bits, see alignment 1.1e-19 TIGR00417: spermidine synthase" amino acids 6 to 277 (272 residues), 372.8 bits, see alignment E=4.7e-116 PF01564: Spermine_synth" amino acids 60 to 240 (181 residues), 235.4 bits, see alignment E=3.7e-74

Best Hits

Swiss-Prot: 69% identical to SPEE_METJA: Polyamine aminopropyltransferase (speE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to mmp:MMP1584)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWX0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>MMP_RS08145 polyamine aminopropyltransferase (Methanococcus maripaludis S2)
MKFDAWYTEPQTENLSLSTKLKDILYVGQSEYQEIQVLDTYEFGRVLILENTYQTTERDE
FIYHELISHPALFTHGNPKKVLVIGGGDGGSVREVLKHKSVEKIDFVELDGQVVEVAKKF
LPTLSCEIDNEKVNTIITDGIKYVAETSEKYDVILVDCPDPVGPAAGLFEKEFYNNLYKC
LNDDGIMVQQTESPLLHEKLINKIKGHLKDAGFSTIRPLVCSIPTYPSGFWSFTLASKKN
DPLNSDVSEIENKLKDMTTKYYDQDVHKGVFLATPRYLKE