Protein Info for MMP_RS08140 in Methanococcus maripaludis S2
Annotation: adenosylmethionine decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to SPEH_METMP: S-adenosylmethionine decarboxylase proenzyme (speH) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 99% identity to mmp:MMP1583)Predicted SEED Role
"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1B" in subsystem Polyamine Metabolism (EC 4.1.1.50)
MetaCyc Pathways
- superpathway of arginine and polyamine biosynthesis (13/17 steps found)
- spermidine biosynthesis I (2/2 steps found)
- spermine biosynthesis (1/2 steps found)
- spermidine biosynthesis III (2/4 steps found)
- aminopropylcadaverine biosynthesis (1/3 steps found)
- superpathway of polyamine biosynthesis I (4/8 steps found)
- superpathway of polyamine biosynthesis II (3/8 steps found)
- L-methionine salvage cycle III (5/11 steps found)
- L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.1.50
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LWX1 at UniProt or InterPro
Protein Sequence (122 amino acids)
>MMP_RS08140 adenosylmethionine decarboxylase (Methanococcus maripaludis S2) LKQLGKHIILELWGCESQALDDQPGIEKMLVNAVKACGATLICVKTHKFSPQGVTGVAVL SESHISIHTWPELGYAAMDVFTCGEHVKPEDTIPEIEKFLKPEKTEVMDIKRGIIDDGEV KE