Protein Info for MMP_RS08135 in Methanococcus maripaludis S2

Annotation: arginine decarboxylase pyruvoyl-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00286: arginine decarboxylase, pyruvoyl-dependent
  • amino acids 14 to 163 (150 residues), 190.6 bits, E=6.7e-61
• PF01862: PvlArgDC
  • amino acids 14 to 162 (149 residues), 147 bits, E=2.4e-47

Best Hits

Swiss-Prot: 100% identical to PDAD_METMP: Pyruvoyl-dependent arginine decarboxylase (pdaD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02626, arginine decarboxylase [EC: 4.1.1.19] (inferred from 96% identity to mmz:MmarC7_0829)

Predicted SEED Role

"Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19)" (EC 4.1.1.19)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• arginine dependent acid resistance (1/1 steps found)
• spermidine biosynthesis III (2/4 steps found)
• superpathway of putrescine biosynthesis (2/4 steps found)
• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (1/3 steps found)
• putrescine biosynthesis II (1/3 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)
• superpathway of polyamine biosynthesis II (3/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (2/11 steps found)
• superpathway of L-arginine and L-ornithine degradation (3/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.19

Sequence Analysis Tools

See Q6LWX2 at UniProt or InterPro

Protein Sequence (164 amino acids)

>MMP_RS08135 arginine decarboxylase  pyruvoyl-dependent (Methanococcus maripaludis S2)
MIKSSAIHSPFEAPNTISLVAGTGDANNPLNAFDMSLLKSGIGNLNLIRISSIMPPKADI
IPLPKIPQGSLVPTAYGYQISEIKGETVAAGISVAIPKDKELCGLIMEYECIGGKKECED
TVRNMAKEGFEMRGWEIDEIISIASEHTVENIGCAFAAAALWYK