Protein Info for MMP_RS08120 in Methanococcus maripaludis S2

Annotation: 30S ribosomal protein S15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF08069: Ribosomal_S13_N" amino acids 1 to 60 (60 residues), 86.1 bits, see alignment E=1.4e-28 PF00312: Ribosomal_S15" amino acids 82 to 148 (67 residues), 60.3 bits, see alignment E=1.7e-20

Best Hits

Swiss-Prot: 100% identical to RS15_METMP: 30S ribosomal protein S15 (rps15) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02956, small subunit ribosomal protein S15 (inferred from 97% identity to mmx:MmarC6_1091)

Predicted SEED Role

"SSU ribosomal protein S13e (S15p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWX5 at UniProt or InterPro

Protein Sequence (151 amino acids)

>MMP_RS08120 30S ribosomal protein S15 (Methanococcus maripaludis S2)
MARLHSGKRGSSGSTRPLRTEVPEWVSMSAEDIEAKIVEMAKDGKQSAIIGNILRDMYGV
PNVKLITGKSVSSIMKEAGFYAEVPEDLFNLMKKAINLRNHLENNPRDTHSTVGLKLIES
KIRRLVKYYRGTKVLPAKWRYSPETARLLVE