Protein Info for MMP_RS08115 in Methanococcus maripaludis S2

Annotation: nicotinamide-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 TIGR00125: cytidyltransferase-like domain" amino acids 2 to 64 (63 residues), 51.7 bits, see alignment E=7.5e-18 TIGR01527: nicotinamide-nucleotide adenylyltransferase" amino acids 2 to 164 (163 residues), 238.2 bits, see alignment E=3.5e-75 PF01467: CTP_transf_like" amino acids 5 to 131 (127 residues), 67.3 bits, see alignment E=8.3e-23

Best Hits

Swiss-Prot: 100% identical to NADM_METMP: Nicotinamide-nucleotide adenylyltransferase (MMP1578) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00952, nicotinamide-nucleotide adenylyltransferase [EC: 2.7.7.1] (inferred from 100% identity to mmp:MMP1578)

MetaCyc: 42% identical to nicotinamide mononucleotide adenylyltransferase subunit (Saccharolobus solfataricus)
Nicotinamide-nucleotide adenylyltransferase. [EC: 2.7.7.1]

Predicted SEED Role

"Nicotinamide-nucleotide adenylyltransferase, NadM family (EC 2.7.7.1)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWX6 at UniProt or InterPro

Protein Sequence (171 amino acids)

>MMP_RS08115 nicotinamide-nucleotide adenylyltransferase (Methanococcus maripaludis S2)
MRAFLIGRWQPFHKGHLEIIKKISAEVDEIIVGIGSCQKSHTLTDPFTAGERMMMITKTL
ENYDINYYAIPIIDIDYNAVWVSSVESLTPPFTTIYTGNSLVRELFSERNYVVKKPELYN
RTDYSGTKIRKKMLEGSAWEHLVPEEVVKVIEEIDGINRIRRLSEKDYDEE