Protein Info for MMP_RS08100 in Methanococcus maripaludis S2

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00155: Aminotran_1_2" amino acids 28 to 364 (337 residues), 193.3 bits, see alignment E=1.1e-60 PF01041: DegT_DnrJ_EryC1" amino acids 64 to 203 (140 residues), 21.6 bits, see alignment E=1.8e-08 PF01053: Cys_Met_Meta_PP" amino acids 67 to 200 (134 residues), 28.2 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 71% identical to BIOF_METVS: Putative 8-amino-7-oxononanoate synthase (bioF) from Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 100% identity to mmp:MMP1574)

MetaCyc: 43% identical to BioF (Lysinibacillus sphaericus)
8-amino-7-oxononanoate synthase. [EC: 2.3.1.47]

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWY0 at UniProt or InterPro

Protein Sequence (370 amino acids)

>MMP_RS08100 8-amino-7-oxononanoate synthase (Methanococcus maripaludis S2)
MFRKNLKKELDLIKNQNLYRKLKLEDNICLNFSTNDYLGLSKNNEVIKAYNDGLNYGAGA
TGSRLTSGNINHENLEETISEFKGTEKSLVYSSGYGTNLGVISALCKKGDLVLSDELNHA
SIVDGIRLSRADKKIYSHNNMHELIEILENSRNYENKFIVSDAVFSMDGDIAPVDELKKI
ADKYNAVLILDDAHGTGVLGKGRGTLHHFKIKPADNIIQIGTLSKAVGTVGGFVSGIEEL
IEYLINTSRSFIYSTALPPAVISASIKSFELIKSGELTDKLSKNINTANKIFKSSGFIEE
EKITPIYPFIFGEDSIKISEELLKYKIFCVGIRYPTVKRGSERIRLSITAENKKEDFEYL
CECISKIKNG