Protein Info for MMP_RS08055 in Methanococcus maripaludis S2

Annotation: tetrahydromethanopterin S-methyltransferase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 231 to 251 (21 residues), see Phobius details TIGR01111: tetrahydromethanopterin S-methyltransferase, subunit A" amino acids 1 to 245 (245 residues), 305.6 bits, see alignment E=2.5e-95 PF04208: MtrA" amino acids 4 to 173 (170 residues), 265.2 bits, see alignment E=2.2e-83 PF09472: MtrF" amino acids 187 to 248 (62 residues), 77.6 bits, see alignment E=4.5e-26 TIGR02507: tetrahydromethanopterin S-methyltransferase, F subunit" amino acids 187 to 251 (65 residues), 111.6 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: K00577, tetrahydromethanopterin S-methyltransferase subunit A [EC: 2.1.1.86] (inferred from 100% identity to mmp:MMP1565)

Predicted SEED Role

"N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit A (EC 2.1.1.86) / N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit F (EC 2.1.1.86)" in subsystem Methanogenesis (EC 2.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.86

Use Curated BLAST to search for 2.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWY9 at UniProt or InterPro

Protein Sequence (253 amino acids)

>MMP_RS08055 tetrahydromethanopterin S-methyltransferase subunit A (Methanococcus maripaludis S2)
MADKKAPAAGWPVANGEYVVGNPESCVAVVTLGSHGLDQAAIDAGAAISGPCHTENLGIE
KVVANYISNPNIRFMVITGSEVQGHITGQCIKALYENGIGDDGGIIGAKGAIPFMENVGT
EPVGRLQSQIVECIDLIDVEDTGKISDAIKNCISKDPGAFEEEPMVIELEGGAAAAGEEE
GGLMIEGIPTVAEPDIESMKSLNEALDYKVGLMTRDIGLASGVQTETVTGLMYGSVFAVA
LIAVPIALKFLMG