Protein Info for MMP_RS08035 in Methanococcus maripaludis S2

Annotation: tetrahydromethanopterin S-methyltransferase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01112: tetrahydromethanopterin S-methyltransferase, subunit D
  • amino acids 1 to 222 (222 residues), 327.9 bits, E=1.6e-102
• PF04207: MtrD
  • amino acids 7 to 221 (215 residues), 307.3 bits, E=3.4e-96

Best Hits

Swiss-Prot: 100% identical to MTRD_METMP: Tetrahydromethanopterin S-methyltransferase subunit D (mtrD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00580, tetrahydromethanopterin S-methyltransferase subunit D [EC: 2.1.1.86] (inferred from 98% identity to mmx:MmarC6_1109)

Predicted SEED Role

"N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit D (EC 2.1.1.86)" in subsystem Methanogenesis (EC 2.1.1.86)

MetaCyc Pathways

• methanogenesis from H₂ and CO₂ (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ II (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (5/6 steps found)
• methanogenesis from acetate (4/6 steps found)
• methanogenesis from methoxylated aromatic compounds (1/3 steps found)
• superpathway of methanogenesis (11/21 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.86

Use Curated BLAST to search for 2.1.1.86

Sequence Analysis Tools

See Q6LWZ3 at UniProt or InterPro

Protein Sequence (235 amino acids)

>MMP_RS08035 tetrahydromethanopterin S-methyltransferase subunit D (Methanococcus maripaludis S2)
MDATSFILPLAEITIAGAIINASVHFVPVGGAPAAMATSTGVGTGTTQLAAGAGFTGLLA
AAAMASQAGVSLSNPVHMLLIMLSGAVGAMIMLGLTMLIGQIIYVYGIGIVPAADKCEKD
PITGDIQKPYITPGTTGHGIPTVCFVSGTIGAALGGLGGALAYIALQQLGFAAAIAGVLA
VGFFFMNAVLASYNIGGTIEGFHDPKFKKMPNGVIASFVSSLIAGAVLIGMAMGL