Protein Info for MMP_RS08030 in Methanococcus maripaludis S2

Annotation: tetrahydromethanopterin S-methyltransferase subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 63 to 80 (18 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details PF04206: MtrE" amino acids 8 to 283 (276 residues), 425.6 bits, see alignment E=3.9e-132 TIGR01113: tetrahydromethanopterin S-methyltransferase, subunit E" amino acids 8 to 297 (290 residues), 459.5 bits, see alignment E=1.9e-142

Best Hits

Swiss-Prot: 100% identical to MTRE_METMP: Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00581, tetrahydromethanopterin S-methyltransferase subunit E [EC: 2.1.1.86] (inferred from 100% identity to mmp:MMP1560)

MetaCyc: 55% identical to tetrahydrosarcinapterin S-methyltransferase subunit E (Methanosarcina thermophila)
Tetrahydromethanopterin S-methyltransferase. [EC: 2.1.1.86]

Predicted SEED Role

"N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit E (EC 2.1.1.86)" in subsystem Methanogenesis (EC 2.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.86

Use Curated BLAST to search for 2.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWZ4 at UniProt or InterPro

Protein Sequence (299 amino acids)

>MMP_RS08030 tetrahydromethanopterin S-methyltransferase subunit E (Methanococcus maripaludis S2)
MDPTLISLGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISG
EPVSYGLYVAVAGTIAWALINAGLNVVLAIIVGAGVAAIVHGAYSVSAFLGRTVGQSKKF
GQPVYMDVLTSHIGPIVGHGFIAVFTMTLAAYLATTALGNPFPLPLVSLIFGITVGAIGS
STGDVHYGAEREYQKYPFGGGIPVANQGDIDIYAEYGVRNGLDSSYFCSRFGGPLTGLCF
GLIIFLDGWRSILGNIIGGDLVTKTSIALLVGLLVVAVAAVINRKLEVYARNKYGPYRN