Protein Info for MMP_RS08020 in Methanococcus maripaludis S2

Annotation: coenzyme-B sulfoethylthiotransferase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF02240: MCR_gamma" amino acids 5 to 250 (246 residues), 427.8 bits, see alignment E=5.4e-133 TIGR03259: methyl-coenzyme M reductase, gamma subunit" amino acids 6 to 250 (245 residues), 453.9 bits, see alignment E=6.3e-141

Best Hits

Swiss-Prot: 94% identical to MCRG_METVA: Methyl-coenzyme M reductase subunit gamma (mcrG) from Methanococcus vannielii

KEGG orthology group: K00402, methyl-coenzyme M reductase gamma subunit [EC: 2.8.4.1] (inferred from 100% identity to mmp:MMP1558)

MetaCyc: 70% identical to gamma subunit (Methanothermobacter thermautotrophicus)
Coenzyme-B sulfoethylthiotransferase. [EC: 2.8.4.1]

Predicted SEED Role

"Methyl coenzyme M reductase gamma subunit (EC 2.8.4.1)" in subsystem Methanogenesis (EC 2.8.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.4.1

Use Curated BLAST to search for 2.8.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWZ6 at UniProt or InterPro

Protein Sequence (260 amino acids)

>MMP_RS08020 coenzyme-B sulfoethylthiotransferase subunit gamma (Methanococcus maripaludis S2)
MAYTPQFYPGATKVAENRRNHLNPNYELEKLREIPDEDVVKIMGHRQPGEDYKTVHPPLE
EMDFVEDYARDLVEPLNGAKEGHRVRYIQFADSMYFAPAQPYDRSRSYMTRLRGVDAGTL
SGRQVVECRESDLEEFSKNILMDTELFDPATSGVRGATVHGHSLRLDENGMMFDALQRCV
FDEKTGHVMYVKDQVGKPLDAPVDVGEPIPEAKLREITTIYRNDGVAMRADPDVIEVVKR
IHRARTLGGYIPTNETFKGL