Protein Info for MMP_RS08010 in Methanococcus maripaludis S2

Annotation: methyl-coenzyme M reductase operon protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR03260: methyl-coenzyme M reductase operon protein D" amino acids 3 to 152 (150 residues), 230 bits, see alignment E=5.4e-73 PF02505: MCR_D" amino acids 4 to 147 (144 residues), 191.8 bits, see alignment E=2.6e-61

Best Hits

Swiss-Prot: 84% identical to MCRD_METVA: Methyl-coenzyme M reductase operon protein D (mcrD) from Methanococcus vannielii

KEGG orthology group: K03422, methyl-coenzyme M reductase subunit D (inferred from 100% identity to mmp:MMP1556)

Predicted SEED Role

"Methyl coenzyme M reductase operon protein D" in subsystem Methanogenesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LWZ8 at UniProt or InterPro

Protein Sequence (159 amino acids)

>MMP_RS08010 methyl-coenzyme M reductase operon protein D (Methanococcus maripaludis S2)
MIELEVFPHRYLKAETTEKFLNRAYSLSKVQRVVIHGESLPNKVGYGPAKGTPVNHSEKK
EITVKGVPVELMLQVGRLWVLLDDESEIEKIEEICKDLFPFGYRLTKGKFLRNDPTVSDF
IKYGESAVDDIDKRLLGATDPRSKFDSSVTIIPKSEKNE