Protein Info for MMP_RS07980 in Methanococcus maripaludis S2

Annotation: UbiX family flavin prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF02441: Flavoprotein" amino acids 3 to 173 (171 residues), 154.7 bits, see alignment E=8.1e-50 TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 4 to 183 (180 residues), 266.7 bits, see alignment E=4.6e-84

Best Hits

Swiss-Prot: 71% identical to UBIX_METJA: Flavin prenyltransferase UbiX (ubiX) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 100% identity to mmp:MMP1552)

MetaCyc: 46% identical to gallate decarboxylase B subunit (Lactiplantibacillus plantarum WCFS1)
Protocatechuate decarboxylase. [EC: 4.1.1.63]; Gallate decarboxylase. [EC: 4.1.1.63, 4.1.1.59]

Predicted SEED Role

"UbiX family decarboxylase associated with menaquinone via futalosine"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.59 or 4.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX02 at UniProt or InterPro

Protein Sequence (185 amino acids)

>MMP_RS07980 UbiX family flavin prenyltransferase (Methanococcus maripaludis S2)
MDEIIVCITGASGVIYSKRLLEVLKEENIKTSLIISNSAKKIIKHELKMEIDEFKKLADN
YYENDNFFSPVASGSHKFKAAVVIPCSMKSLSSIATGYSDNLIGRVCDIALKERRDLIIV
PREMPFSTIHLENMTKLSHLGVSIIPPAPGFYNDPKTIDDLVNFVVGRILDNLKIENKIF
KRWGE