Protein Info for MMP_RS07955 in Methanococcus maripaludis S2

Annotation: FumA C-terminus/TtdB family hydratase beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF05683: Fumerase_C" amino acids 1 to 174 (174 residues), 151.6 bits, see alignment E=9.8e-49 TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type" amino acids 10 to 173 (164 residues), 227.2 bits, see alignment E=6.1e-72

Best Hits

Swiss-Prot: 67% identical to TTDB_METJA: Putative L(+)-tartrate dehydratase subunit beta (MJ0617) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01678, fumarate hydratase subunit beta [EC: 4.2.1.2] (inferred from 100% identity to mmp:MMP1548)

Predicted SEED Role

"Fumarate hydratase class I, aerobic (EC 4.2.1.2); L(+)-tartrate dehydratase beta subunit (EC 4.2.1.32)" (EC 4.2.1.2, EC 4.2.1.32)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2, 4.2.1.32

Use Curated BLAST to search for 4.2.1.2 or 4.2.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX06 at UniProt or InterPro

Protein Sequence (190 amino acids)

>MMP_RS07955 FumA C-terminus/TtdB family hydratase beta subunit (Methanococcus maripaludis S2)
VQLKTPISKEDVKKLKVGDIVYLSGDICTGRDEAHITTIEEKKPPINLENGVIYHAGPIM
KKENETWKCVAIGPTTSARMNGLEEDFIRITNISAIVGKGGMNDKLLNIFEEFGVVYLAA
PGGCAALLADSINKVKNVYHLELGMPEAFWELSVENFGPLIVAMDSHGNSLYSKVNEDVD
KNLENILKNL