Protein Info for MMP_RS07900 in Methanococcus maripaludis S2

Annotation: YeeE/YedE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 46 to 72 (27 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details PF04143: Sulf_transp" amino acids 22 to 145 (124 residues), 33.1 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to mmp:MMP1538)

Predicted SEED Role

"Death on curing protein, Doc toxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LX15 at UniProt or InterPro

Protein Sequence (156 amino acids)

>MMP_RS07900 YeeE/YedE family protein (Methanococcus maripaludis S2)
MSYVPAIATLAFGILLGYLGQRSSMCFCGGIRDYYLMKDTWLVKGLLGFVGGAILGAVIF
NVIGMLPLFPWIATKGLTAIPGDAAGSLGFGAHFIVTIIGGFGVGFLSIIQGGCPFRNYV
MAGEGNQTAMAYVLGLAVGAVVFHMWVAPFVLSILA